TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5SKA1|Q5SKA1_THET8 Iron ABC transporter, permease protein OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) OX=300852 GN=TTHA0747 PE=3 SV=1
MTRALPPALARGLVFLWLVALLLGAVALGVGLGAVAVPPEAVVRALLGLEENPIVTELRLPRVLAGVLVGAALGVSGAAF
QGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQHAVFQHLPLSATFFGFVGALSATLLTLVLAGGVARTGELV
LAGVVVGSVLTGLTTYLMMQDADRVRAVFAYTLGNLAFAGWEGVRLLALFFALAFPPLLFLGRVLNALGLGEETARSLGL
PLEALKLLLLGAASLLTASAVAQAGIIGFVGLVTPHLLRRLLGEDYRLLLPASALGGGALLALADLLARTLARPAELPVG
VVTTLLGGPFFLYLMWRRRGRA