TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5SLB7|Q5SLB7_THET8 Sugar ABC transporter, permease protein OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0376 PE=4 SV=1
MAVSRTSVHILPILGPPAILRQGMRTYPLHWVLGVGVLLALGLYAQRLGFLPAWAAWGLWAGYLLLALWGLLWGGWRAAP
LALGLLAPLFPPLAFLGPLGAALALGRTLPEKA