TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5TKG1|Q5TKG1_ORYSJ Os05g0594700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0594700 PE=2 SV=1
MATVSDIGLSAAINVSMAVAFLLVFAFLRLQPINDRVYFPKWYLRGMRDSPVSSGAAVQKVVNLNMRSYLKFLSWMPAAL
KMPEDELINHAGLDSAVYLRIYLTGIKIFVPISILASLVLFPVNWTNDTLDSMKVVHSKIDKLSISNIPYGSNRFVTHLV
MAYAVTFWTCYVLFREYEIITTMRLRFLASEKRRPDQFTVLVRNIPPDPDESISELVEHFFLVNHPDHYLRHQVVYNANK
LADLVEKKKKLQNWLDYYQLKYERNPSKRPTTKTGFLGCFGSEVDAIEYYKAEIEKIGKEEADERQKIMKDPQSAVPAAF
VSFRSRWGAAVCAQTQQTSNPTVWITEWAPEPRDVYWNNLSIPFVSLTVRRLIVAVAFFFLNFFYVIPIAFVQSLASLEG
IEKALPFLKPLIKIDVIKSFIQGFLPGIALKVFLILLPTILMFMSKFEGLISQSSLERRSASKYYIFLFFNVFLGSIVTG
SALDQLKAYIHQSANEIPRTIGVAIPMRATFFITYVMVDGWTGVAGEILRLRALIIFHLKNFFLVKTEKDREEAMDPGSI
CFDWCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQYESGAQFWPSVHGRIIIALIVSQLLLIG
LLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEED
NMSISEDVGMEEVIVPTKRQSRRNTPAQSKYEGSDTLSLPETVHER