TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5W7C1|Q5W7C1_ORYSJ Os05g0119000 protein OS=Oryza sativa subsp. japonica GN=P0496H07.22 PE=2 SV=1
MMASMAALLQRLLVVVNQVDPGAPGFWREFLVGMLKPVAATAVVAMAVALSFTQRLGLEGEMLYAMARAFLQLSVIGFVL
QFIFTQKSAAWILLAYLFMVTVAGYTAGQRARHVPRGKHIAAVSILAGTSVTMALLVALRVFPFTPRYIIPVAGMMVGNA
MTVTGVTMKKLREDVGMQRGVVETALALGATPRQATARQVRRSLVIALSPVIDNAKTVGLIALPGAMTGLIMGGASPLEA
IQLQIVVMNMLMGASTVSSILSTYLCWPAFFTGAFQLNDAVFAAD