TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5ZU34|Q5ZU34_LEGPH Major outer membrane protein OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lpg1974 PE=4 SV=1
MFSLKKTTAAVFALGSSALFAGTMGPVCTPGNVTVPCERTAWDIGITALYLQPTYDADWGYNGFTDVGGWRNWHDVDLEW
DWGFKLEGSYHFNTGNDINVNWYHLDANTDHWAFVDQLHAYDITWDAVNAELGQFVDFSANKKMRFHGGVQYAYIKTDVN
RHLNGFFLDNFNSKFNGFGPRTGLDMNYVFGNGFGIYAKSAVAILVGTSKFVDNCTVCGFSYGSKNAIVPEVEMKLGADY
TYAMAQGDLTLDVGYMWFNYFNALHNTAAVNVGLGTSLETDFSASGPYIGLKYVGNV