TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q61835|MAT8_MOUSE CHLORIDE CONDUCTANCE INDUCER PROTEIN MAT-8 PRECURSOR (MAMMARY TUMOR 8 KDA PROTEIN) (PHOSPHOLEMMAN-LIKE) (FXYD DOMAIN-CONTAINING ION TRANSPORT REGULATOR 3) - Mus musculus (Mouse).
MQEVVLSLLVLLAGLPTLDANDPENKNDPFYYDWYSLRVGGLICAGILCALGIIVLMSGKCKCKFRQKPSHRPGEGPPLI
TPGSAHNC