TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q63016|LAT1_RAT Large neutral amino acids transporter small subunit 1 (L-type amino acid transporter 1) (4F2 light chain) (4F2 LC) (4F2LC) (Integral membrane protein E16) (TA1 protein) - Rattus norvegicus (Rat).
MAVAGAKRRAVAAPATTAAEEERQAREKMLEARRGDGADPEGEGVTLQRNITLINGVAIIVGTIIGSGIFVTPTGVLKEA
GSPGLSLVVWAVCGVFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKP
VFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFIQMGKDIGQGDASNLHQKLSFEG
TNLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTLSTNQMLTSEAVAVDF
GNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLMYAFSRDIFS
IINFFSFFNWLCVALAIIGMMWLRFKKPELERPIKVNLALPVFFILACLFLIAVSFWKTPLECGIGFAIILSGLPVYFFG
VWWKNKPKWILQVIFSVTVLCQKLMQVVPQET