TCDB is operated by the Saier Lab Bioinformatics Group
>Q63113|FXYD4_RAT FXYD domain-containing ion transport regulator 4 - Rattus norvegicus (Rat).
MEGITCAFLLVLAGLPVLEANGPVDKGSPFYYDWESLQLGGMIFGGLLCIAGIAMALSGKCKCRRNHTPSSLPEKVTPLI
TPGSAST