TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q64VG5|Q64VG5_BACFR Uncharacterized protein OS=Bacteroides fragilis (strain YCH46) GN=BF1764 PE=4 SV=1
MNIKRFLLLGIVALYAIIPAWGQAQKVEIRGSVIDDEGEPAISIVIRDQNEKGDVYGITDLDGKFKIMADPNTTLHFSGF
AYASKTVKLKGKTTINVVISYEASMIDEVVITAKKVVDKLLPEPTDIEIVGNQYIIHPKVKIPKEMYKPNTRIVVQPMLV
NITRKTQSLFRPAVVTGKEYAITLERMMEFDLSRDPLAAFQEKTQKIDKNEVIAYVDSLYMDNPDDECRCDIYMYLVEYK
KLAYKDTVVIAKGTVNPMRFFTYQADGMKIRDEKYIPKPQKQQRGDRGEVKLNFLINSATIDEKDPNNQRELEKMRLRLQ
EIENDPNSEFLSFSVKGVSSPEGPYQSNLKLAKKRTDSTLKRIFGFLNEGTINAIKDSTYTEGVVASWEEVAELMERDSL
PTDKLREIINCYPDNMASQYSRILRLPEYRNVILTTYLPRLRRVEYSFNYSVMRLLNDEEIRIMYKQDYKKLVPYEFWRI
YLDADNDSTREVICRQALEQYPKFMIMANELAALLIEQKKADSKLLEPFVSRSAPTELLCNQVIALMDERAYNRADSIID
FLPDNDMTQDVRAIVGAYNGHFEDAYERFGTQGGINEVVLLMAMKQNEEAWEKAQELPDEPLSYYLRAACANRLDKVSEA
YAFIKRALNEDPSLKEIAQIDGDVTDLLQQLEDEKKELKEKAEKTKEKTETEESETEESGLNEEKTIKQ