TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6AWP0|Q6AWP0_DROME CG3814, isoform A OS=Drosophila melanogaster GN=BEST:CK02213 PE=2 SV=1
MSSDNHFQYDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAVLIVTMIC
MACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVF
IIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSRN