TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q6DWJ6|GP139_HUMAN Probable G-protein coupled receptor 139 OS=Homo sapiens OX=9606 GN=GPR139 PE=2 SV=1
MEHTHAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQKSSYNYLLALAAADILVLFFI
VFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHTSIWITVPLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYITCFLTS
IPYYWWPNIWTEDYISTSVHHVLIWIHCFTVYLVPCSIFFILNSIIVYKLRRKSNFRLRGYSTGKTTAILFTITSIFATL
WAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFS
ITSSPWISPANSHCIKMLVYQYDKNGKPIKVSP