TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6FBB3|Q6FBB3_ACIAD Putative benzoate transport protein (BenK-like)(MFS superfamily) OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD1815 PE=4 SV=1
MSTMSLNINDLLNQAKFSKFHLSVVFWCTLINICDGYDLVIYGVVLPRLMEQWSLTSVQAGMLASTAMCGMLVGALSCGI
LADKFGRKRVLLLCVFFLSTFTLLGSFASTPTEFAILRFLAGLGIGGAMPNVVALTSEYSPKKSRVTMVSIMSCGYAVGA
IISALVGSILVERFGWQIMFILAGIPLLFIPIIWKYLPESLVFNVKKNNTEKAHALIAKVDPTVLVSQHTKLVLNESLEK
AYGSRRVLFQEGRAAGTLKFWIAFFMCLLVVYALSSWLPKLMYNAGYPLGKSILFLLAMNVGGIIGGTTSGMLADKFKIK
PVVISLFCIAALSLIALGFNTSAIILYTLVAVAGASIQGASILLYSYVAQFYPLVANSTGIGWASAIGRTGAIMGPILAG
MLLVLNLPHLMNFVLISVPALIAAISIGFLTTSKKKVEQPVALVTQQSLE