TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6GUB1|Q6GUB1_RHIET Permease protein BioN OS=Rhizobium etli GN=bioN PE=4 SV=1
MQSLYVEGNSRMHRLSPRAKLLSLTAFAILLFISHNLLLLSGAVLVAAVLYGTVGLPIGEALLRLRPIFLTIAVVALFNL
IFNPWQAALVPVLRLTALMLLAASVTATTTITEFIDEVTALARPLERTGRVQADDIGLALGLVLRFVPEIVNRYQAIREA
HKARGLKVRPTSLLAPLIILTLKDADNVAAAIDARRIRRHGS