TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6GUB2|Q6GUB2_RHIET ATP-binding protein BioM OS=Rhizobium etli GN=bioM PE=4 SV=1
MNIQFESAGVSFGARVALEPLTLAITGKRIGVIGLNGSGKTTFARLVNGLTKPTTGRVIVNGPSIRPTRRRLSPHVGLHL
SSREQNQIILPIVKYDIAFGLKRRGLSKAEIEARVEGVLARFGAEALADRRAHEASGGELQVAALCSVLATGPGILILDE
PTNQLDLKNRALVERIIAGLPESAIVITHDLELIAGFERVLVFHEGRLAADEPAAEAIARYREIAA