TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6IVD6|Q6IVD6_STRPU Receptor for egg jelly 4 (Fragment) OS=Strongylocentrotus purpuratus GN=REJ4 PE=2 SV=1
MEVLTWKFVFLVITSHLAITGSGVRANENLFTVSIPSLLEVNQTFEIAFWTDFPFFFECYWDFNDNIIYIANATDLQEPL
IHKYTQPAAYNILTNCCMAGQLEAHFSEVLVYSEIYYEICSYRSVNLTYNYDIYILGESDLLIFNHHEFPDPLYYYMELD
GYPVFDEVFSHGALQNDDLYAVLLDTLPFPMELQNIIGLGPHNVSVTVYSEINNTAVYCESQIKFVELITGMVFYISEYF
VQTNNPFIGSLAAESGWPALIEWSAYNEDTFELEFYFDSYRQARSPDEVDEVWLFISKPGNYTLRATMYHEINEASEYTT
IIVENPITTLDISLNAPLHYPLEDTLQMFVNYTSDGIPTDIXGDIDYGDGTIEWWEPIPSEPDYRNLTFNHLYAVPDLYT
VQLFLYNYVSSVQYEWYVAVLEDIEDLAIDSFSGEDGTWTAILPIEFPVILTAQPLKGTIELCEWNVGGYLFNSTNPTIM
YEFNAEGVYDIEVRATNAFSSGRASTNVTVLESITGIYLINDGPVMQADAVTFVLFSYQLGSNSLFALDYGDGTSETLQE
PRIQENVTMYIPSDLDLPFNPREYFSVRVEHTYVSAGSYTATASASDAVSIRHAMSDAFVQASPCFLPNMHILDGESSYS
XAKQYHRQKRFQFAAEVNIDCVMAASTHYEWLVFKLNDVFTVPVDENLYQLPASIRTDLTTLYVPAFTLEYGTYVFRLHV
TINLRDGSVGVNKNDQTYIRVVESPLYAVINGGSSRAIGWYRDIYMDGSLSKDPDVDGNQDGLLFSWFCRRSNETFPSND
DLLLLVNQPSGDDGCLHEGFLMQSGNQTTMTIAGQTLEGNQTHVFRLVVSKQGRGTAHAEQTIPILPGDPPTILIKCMTN
CGFSLNPSERFVISANCDDCTLQTRPRYFWSLIPAFLNNSKQFLIWNQDTTTSRTNAYLAIRAFTFQGSEEYTLKVLVFS
WSGAKTFAEYAFSTNSPPLLGTCSATPDEGVVLETHFTIICQGFVDEDEPLSYEVRALTGSEKKTGISSFHDSSTSGTLI
YFGVDPHIPPTFLPVGIASHCDHQVDIIITVSDTYGASIKTSTAVKVREAEVDTSQPDKTVTDTVLEFSSGEENPLSKLL
ESGDTQSATQLVFTLTSLLNADAESDFDQAEAATEEEQEEESEFMEEKKTKRAEARESIIANIGHIEVRDMETLQQTSAV
IAQVTQEKDEISATAQKSAAKSYQEMCHFLKEESGSGHTGGDTVEETASFIMVGLSNIMEAAFSTLTSVVNETTPVTSQD
DDAEKAISDTRNVSMATLQALEELQTAVLQNKVPGEESTVIRTEAVSLILQRQERWEVASKVSDSKAGATSFQLPSNVLD
GGTESSFDDIVDSHIHEYNHNPFAWASMGGEDDITSQVSSLELELSDGNQHTKLTPVNLPKDIDIFIDNEDTKVQQLQAA
KESQSGEINYYFNVISQMAYVVVEVVVYNHSLYEPFPELSLFLTRNETGTNSSAGVDATHILNTSFPAGADPPVSALNDT
HNMTGNPYLWIIPFSEIGVNGDHGLVLSGWGMVNKSDIALYAYGAQCVYWNTEEEMWDTTGCKVGPLTSRILAHCQCNHL
SHFAAGFVVLPNTVHFIKDASLFAKILENPITAMTVGSVFALYVLVAVWANRHDRRAEEQARVIFLGDNNPEAQYNYHVT
IFTGLRRVAGTTAVATITLYGAAGSSEPHVLTTEGKRKILQRGGVDSFVLSTHGSLEELTAVRVWHDNSGKQPEWHLNRI
LVHDLQTKQLWYFLCHTWLAVDLGECTVDKTFPVATTEDLQQFQHLFITGLLRDMKDHHLWVSIFTRPPNSNFTRLQRIT
CCFTLLMMSMLASIMFFGITPEDVDVGDSKGPEMSQEIGMGTIRVTWFDILVGIESGLLVLPGNLLILEIFRNVRSRHPS
KGDKSVEIVAESEDDKSGTTKTTSEQSTKSIATASLKASDGENVPHHAGDGSQNHSEQIPSEAQSPETITQEKMNNEHDI
ESQIQPVAQSVWIDSASNECSKSADVSVRSIHVSTTEEIPPCCCLRPCYKGSEHDDVVSGGGDDRLHRTASSSVLSSSDS
QPESLSPEATELQNRPPFFMRHEDYLHHHINTMHEEIYHAPEGYFKSEEDRKKALRKLEETLKVHGWYQHLQEEEEGHAA
TEDQDKSGCCQGDSQGCLPWWFVYIGWFFVVVTNLVCGYLVILYGLTYGLQTSMDWLVSMMVSLFQSIFVLQPGKVILVA
AFSAVIWKKHEXDDVGVDLFTDPATGIFMTPANAKGRGKRHTIARYYQPPTIESVNQVRERREAEAKMCKMLKELLGQIL
LVVLALEVAHFQRDPNNYLFHQTVANTFTAGFEDVSSINDVYGYLEESFVPELYGENRGFLGDESTYRVGRARLRQVRII
PDACTPPKPTQHIVNCTGILRSQSHTNQQTYNKSWSELLEDDTESKAITDSYGPWKFTPSRSSHGSYHMGTVTLYTQGGY
IQVLSSTARSTLRVLQELEDRKWLDELTRALYIEWTVFSADAGLMCVCTVLFEATTMGNLVSTGEFHAFKIFSLETVVDK
INLALQSVYLLVILGLIHLEVKKMRRKKRAYFQFWNILNILTIILSILSAVFYSLWATSLHKAMKDYTQNPSKFISFFYP
VIMDQTFMAVTGFLVFINTLRCAKILRFNSSIQTIHHTFSNITSEFFIFTLMVLIFLFAFALLFCVTFGSDVMDFKDVAF
SFQTIFLFLEGGYEEFMDVSEIYATLGPLYFIFMTIALFFLLFNFYILLILYAFRDARHILPNEDHKDVLSAIVDWLFSV
CSIRKVSRKDETMKSAPVFKHYRGELTLE