TCDB is operated by the Saier Lab Bioinformatics Group
>Q6KYW8|Q6KYW8_PICTO Multi drug ABC transporter ATP binding protein - Picrophilus torridus.
MEISIRNLTKRYGRILALNKINMHASGPGCIAILGPNGAGKTTMLKLISNIIKPTDGSVLINNINVSDYPERALKYLGAL
IEQPEFYYYLNGYEILKFAAKVKGLKNNIDDEIKRLADLTDMNDYLYRKTGTYSRGMKQRLALAVAMIGDPEIIILDEPT
FGLDPKGMAYIRDLIKNLSREKLVILSTHLIYEAKEVSNRTLIIDHGEIKYDSINSDNKRKILVTFDGSISNIKSDFIRD
FVIDKNRIIITPREDADNYNIIYDLIKNGVKVNSAQDYDDLEETYISITS