TCDB is operated by the Saier Lab Bioinformatics Group
>Q6KYW9|Q6KYW9_PICTO Multi drug ABC transporter permease protein - Picrophilus torridus.
MGNLYNVYMQYVKNYYRSKSFYLMLTLILVISILMTYFSLKYVNDLPAFLGRNVSFHLKKILFYFIWSFVLINIPVFSSV
FFGSPAISSEIENKTAYYIFPLPINRYKLYIGKYLSAFTVTFIIVLIYSSFEVIILHYLFGSIPLSFYYSIGLLAIFIFT
ILSITFMISSIFNKNTYAYITVFIIYYIVFEAGSLIINLLYKITPIYLLNEAADIVEKVYLNINTSSFVTSPSLAPATNT
EIYTSVLIMIIYMIISFVAGIIIFERKEVS