TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MB84|Q6MB84_PARUW Putative conjugative transfer protein traD OS=Protochlamydia amoebophila (strain UWE25) GN=traD PE=4 SV=1
MKLFQTITEGGQLTTHSVRMFKQVTKTSFFITFVLWIIVFLYQMRDVNTFYLQNVLYFEQARFYQVLHIDTIKVDPSFGL
QRGSQDVKEYTTDQVLRLTKPYADRFYRITKQRFQHSAFWALAPLSVVFAIFFFRGRQSIKKHHLKGNTLSSVWLTRWKL
KLSRRASPISIGSLPLIKGTETQHIMITGGTGSGKTNCLHHLLKSVRQQKQRAIIVDTTGLLTERYYRAGKDILLNPLDS
RGAPWHPWIECIDKTSYATMAESFIPQSLSDSDNYWRTSARIVLGSLFEQLKDIQKNSTLADKILRDPLQELCDFVQGTK
AASLIDMNSEKTAASIRAVMSNFLTCFELLANTDQPFSIREWIQQEDPIDNWLFISCKTNERAALNPLLSCWLSVAVRSL
LALPPNFERRLWYIIDELPTLNRLRDLDMLLAESRKYGGCAVLALQSPAQLEAIYGQAVAQTLIGNCATKIVFAEQNPLH
AGRLADMFGEQEIREYQKGLSYGANDIRDGVSLNQQTRYQQLITKTDIQFLSRNQAFVRLPDNCPIVRLNVPILPR