TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MB86|Q6MB86_PARUW Putative F pilus assembly protein traH OS=Protochlamydia amoebophila (strain UWE25) GN=traH PE=4 SV=1
MKPLLFFILLSFSLTLRADLHNDLKSYLSELNTYSHVDKNEIYHSQRAGYMTGGGISIRNGASHTALAQVSLPKFDAGCG
GIDIFTGGISFISHDQLIAALKNIASSAQGYAFMLGIETVSPLIASTMKQMETWANAINSLGINSCEVATGLVGSVWPAR
TAAKQQICRSAKNGGFASSFINARHQCADEGDYAKTMQSMAKDPLYDGMLLEEYNLTWKAVQKHPFLAKKENRKMAEEIM
SLTGTLIIRRDKSLVVEPWPSRIYDDSFLPILLEGGTTRVYQCTGGNAKQNCLALEMKELTIPAEQAWKGRIKQALATIQ
QKILADTPLASEEIDLLSKSRLPLFKIVNVLTAYKREVSPISLYEVAEIVGNEMLIQYLREIIGTVRLAAIQLERGQMYD
FDSQKFIEELERVEKVVSRYEERHYQRLEAENQLMLKIETLEQKIASQIILF