TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MF32|Q6MF32_PARUW Putative uncharacterized protein OS=Protochlamydia amoebophila (strain UWE25) GN=pc0093 PE=4 SV=1
MLDYQKILSSLIPLFLILTCSNVYSLEFVCDDPQANLMEDLEVVEYWNRRQNERLPVTYNHLLQGGYFAMPSARMGQEGE
IGTGYAWVPPYYSYNLRFQLVDFLEISGNYRVFRGVDDPVLTPLGFGDFSDKGANVKLSLFSPEASHYDLPGLAIGMEDF
LGTQAFKAYYIVLTQVFLKNNLEISLGYGAHRIHKWFGGMTWFPFRQTKWTYFQNLAFILEYDAIPYKDETLERHPKGRI
KHTHWNIGIKYRLWDSIDLSVSYIRGDAIAFSASSYYNFGSTKGMIPKISDPLPYKSPVNTQAIGALRPDDAIVQDLTYA
MRDQGIDLLEAWLSNEQEKLTLRLKVCNMAYREEQRFRERLYALLGALTPENIDEVIVVLDAVPALIQEYHFNMEYIRLY
KEQAIGGYELGILTPMHEVSYPNPFKSKLLFTKKREWFNLELLPKVHTLFGSSRGKFKYALGLTLALNGFLQNNVYYSIK
FGYFALSNLHDIHSVDRLNPSQLINVRTDIINYFQQKSITIDEAYLEKIWNWGSGWYTRISLGLLEQEYGGVGTEWLYYP
VNSNWAIGMDFAILKKRTPHGVDFTSKIRKLDGFTPHYLKFIGSQYFLNIYYDWKNTGLEFKISAGKFLADDFGVRTEIS
RYFPSGLRIGFWATYTNGHDVINGQTYHDKGLYFSLPLDIFYTKSSRSKWGYGMSAWLRDIGVRAYTGTELYLMINQNRQ