TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MK69|Q6MK69_BDEBA ABC-type transporter with fused ATP-binding and permease domain OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=Bd2542 PE=4 SV=1
MKSLFAEVVFTRIHARITVLICSLVAAVLGLMGPFFQKEFIDQLTGVESKLHFIQFDHTLSYIIGAFFCVLLAQAFSQLT
NFLSVREALHMQKVFAKRLYNKTLHLRVDTMSGRPVGEIVSLYATDVQGATVFLDQTLPAGASTLFPLILAPFAISLLFD
IPLWPTVLVMLGISCLNTFMAFRQSKFFFNFKQLAAERIGLVNEWIQNIRTIRILSWTHHFERNIFAKREIETRNRVSMV
TNGQMMNSISTSITFFLNVVALATLVFYSKHTLTSGELLALLWIVAVFLTRPFRQMPWFFTFAFDSWTSLRRLEEFFSTQ
NNETSQTSQERRHAELADKYALQVRGLNLTVAQRKILKNVDLDIAHGEFVAVVGEVGAGKSMLLLSLLKETGAHFDFYHL
GGKNALNVPVDEVRAHFAYVPQEGFIMNATLRENVAFLYDIEAERDPMVEESLRLAQFDLDTERVEKGLNTEIGERGVNL
SGGQKQRVGLARVHYHEAPIMLLDDCLSAVDVDTEQKLFEQLLLGAWADRTRLLVTHRLSALHRVDRILFMEDGQIIDSG
TYEELLARNEKFREYTTSVAKEATEKESAKKAEVSHV