TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q6RH51|TAUZ_PARPN Hypothetical UPF0324 membrane protein tauZ - Paracoccus pantotrophus (Thiosphaera pantotropha).
MISTMIPSRGLIEEAFPGFAVSALVAATAQFLSDHYGAPAMLLALLLGLALNFLAEDGTRTAPGIAFTARTVLRLGVALL
GARISAGMLAALGPGAIALVVAGVVLTILFALAASRLVGRGWRFALLTGGSVAICGASAAMAIAAVLPRYEKSERDLVFT
VLSVTVLSTVAMVLYPMLAGLFGFTARDSGVFLGGTIHDVAQVVGAGFSIGPETGETATLVKLIRVSMLAPVVLCFSLAI
RARGLADADGGKAPPLLPGFVIGFLALAGLNSLGLIPQGVSDFAGQVSRWALLIAIAAVGIKTSLGKMLEVGTGAIALIL
AETVFLAVFVTAGLHLLG