TCDB is operated by the Saier Lab Bioinformatics Group
>Q6RH59|TAUZ_PARDE UPF0324 membrane protein tauZ - Paracoccus denitrificans.
MISTMIPSRGLIEAAFPGFAVSALVAATAQFLSDHYGAPAMLLALLLGLALNFLAEDGTRTAPGVAFTARTVLRLGVALL
GARISAGMLAALGPGAIALVAAGVVLTILFALAASRLVGRGWRFALLTGGSVAICGASAAMAIAAVLPRHEKSERDLVFT
VLSVTVLSTVAMVLYPMLAGFFGFTARDSGVFLGGTIHDVAQVVGAGFSIGPEAGETATLVKLIRVSMLAPVVLCFSLAI
RARGLADSRGGKAPPLLPGFVIGFLVLAALNSLGLVPAAVSELAGQLSRWALLIAIAAVGIKTSLKKMFEVGTGAIALIL
AETVFLAVFVTIGLHVLG