TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6RW54|Q6RW54_ENTAE Outer membrane porin protein OS=Enterobacter aerogenes GN=omp35 PE=4 SV=1
MKRNILAVVIPALLVAGAANAAEIYNKNGNKLDFYGKMVGEHVWTTNGDTSSDDTTYARIGLKGETQINDQLIGYGQWEY
NMDASNVEGSQTTKTRLAFAGLKAGEYGSFDYGRNYGAIYDVESATDMLVEWGGDGWNYTDNFMTGRTNGVATYRNSDFF
GLVDGLSFALQYQGKNDHDRSIRKQNGDGFSTAATYAFDNGIALSAGYANSNRSVDQKRDGNGDKAEAWATSAKYDANNI
YAAVMYSQTYNMTPEEDDHFAGKTQNFEAVVQYQFDFGLRPSLGYVQTKGKNLQARGGFGGGDADLVKYVELGTWYYFNK
NMNVYAAYKFNQLDDNAYTRAAGVATDDQAAVGIVYQF