TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6VV64 Two-pore-domain potassium channel TRESK (2P K ion channel TRESK) - Mus musculus (Mouse).
MEAEEPPEARRCCPEALGKARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVEGRPDPEAEENPELKKFLDDLCNIL
KCNLTVVEGSRKNLCEHLQHLKPQWLKAPQDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLT
DIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELF
ERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETEL
GFEDAFYFCFVTLTTIGFGDIVLVHPHFFLFFSIYIIVGMEILFIAFKLMQNRLLHTYKTLMLFVCQREVSLPW