TCDB is operated by the Saier Lab Bioinformatics Group
>Q6VV68|Q6VV68_BURPS Inner membrane protein - Burkholderia pseudomallei (Pseudomonas pseudomallei).
MAKFFIDRPIFAWVIAIILMLAGVAAIFTLPIAQYPTIAPPSIQITANYPGASAKTVEDTVTQVIEQQMSGLDNFLYMSS
TSDDSGNATITITFAPGTNPDIAQVQVQNKLSLATPILPQVVQQLGLSVTKSSSSFLLVLAFNSEDGSMNKYDLANYVAL
HVKDPISRINGVGTVTLFGSQYAMRIWLDPTKLTNYGLTPVDVTSAISAQNVQIAGGQLGGTPAVPGTVLQATITEATLL
QTPEQFGNILLKVNQDGSQVRLKDVAQIGLGGETYNFDTKYNGQPTAALGIQLATNANALATAKAVRAKIDEMSAYFPHG
LVVKYPYDTTPFVRLSIEEVVKTLLEGIVLVFLVMYLFLQNLRATIIPTIAVPVVLLGTFAIMSMVGFSINVLSMFGLVL
AIGLLVDDAIVVVENVERVMAEEGLPPKEATRKAMGQITGALVGVALVLSAVFVPVAFSGGSVGAIYRQFSLTIVSAMVL
SVLVALILTPALCATILKPIPQGHHEEKKGFFGWFNRTFNSSRDKYHVGVHHVIKRSGRWLIIYLAVIVAVGLLFVRLPK
SFLPDEDQGLMFVIVQTPSGSTQETTARTLANISDYLLTQEKDIVESAFTVNGFSFAGRGQNSGLVFVKLKDYSQRQSSD
QKVQALIGRMFGRYAGYKDALVIPFNPPSIPELGTAAGFDFELTDNAGLGHDALMAARNQLLGMAAKDPTLRGVRPNGLN
DTPQYKVDIDREKANALGVTADAIDQTFSIAWASKYVNNFLDTDGRIKKVYVQSDAPFRMTPEDMNIWYVRNGSGGMVPF
SAFATGHWTYGSPKLERYNGISAMEIQGQAAPGKSTGQAMTAMETLAKKLPTGIGYSWTGLSFQEIQSGSQAPILYAISI
LVVFLCLAALYESWSIPFSVIMVVPLGVIGALLAATLRGLENDVFFQVGLLTTVGLSAKNAILIVEFARELQQTEKMGPI
EAALEAARLRLRPILMTSLAFILGVMPLAISNGAGSASQHAIGTGVIGGMITATFLAIFMIPMFFVKVRAVFSGEKEDAD
EALRLAHEHMHRDDKPEHGDDAGKKD