TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q6W5P4|NPSR1_HUMAN Neuropeptide S receptor OS=Homo sapiens OX=9606 GN=NPSR1 PE=1 SV=1
MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLFVFTIVGNSVVLFSTWRRKKK
SRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGE
KQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPA
LNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI