TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q72IT8|Q72IT8_THET2 Cytochrome C-type biogenesis protein ccdA OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ccdA PE=4 SV=1
MSLSLTAAFLAGVLSFLSPCVLPLVPTYLFYLGGERGRPLFNALFFILGFGAVFFLLGLPFTLLGGLLFEHRQTLARVGG
VVLVLFGLYMLGLRPRWGVSLRYEGETSRPLGAFLLGATLALGWTPCIGPILGAILTLTAVGGGVGFLLAYILGLAVPFF
VVALFADRIKGWLRRAGRISHYVEVLAGVVLVLVGVLLFTGTFTALNTFFLRITPEWLQRYL