TCDB is operated by the Saier Lab Bioinformatics Group
>Q73MJ2|Q73MJ2_TREDE ABC transporter, ATP-binding protein, putative - Treponema denticola.
MNILTLTEISKIYGDLKALDKINLTVEEGEWLSIMGPSGSGKTTLMNIIGCMDKPSLGKIDLAGQDISKLSSKELTIVRR
DMIGLVFQQFHLVNYLTALENVMMAQYYHSLPDEKEALEALESVGLKERAKHLPNQLSGGEQQRVCIARALINHPKLLLA
DEPTGNLDEKNEKLVMEIFEKLHNAGSTIIVVTHDPEVADQAERMVVLEHGKIARIEKMSRVRPSRGENV