TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q74I63|Y1703_LACJO UPF0397 protein LJ_1703 OS=Lactobacillus johnsonii GN=LJ_1703 PE=3 SV=1
MNNQKGLSVKSVVAIGIGAAIYVILARFTSIPTGIPNTNIEIVYPFLALLATIYGPVVGFSVGFIGHALSDFLMYGQTWW
SWVLATAVLGLIIGLYGMRLDLENGVFTTKQMIGFNIVQIIANVVSWLIIAPVGDILIYSEPQNKVFLQGATATITNSIS
ILILGTILLKAYAATKVKKGSLRRD