TCDB is operated by the Saier Lab Bioinformatics Group
>Q79CI9|Q79CI9_STRSL Nickel transport ATP-binding protein - Streptococcus salivarius.
MFQLNQVACAYEQKKVFTGLDLEIRQGQYVMLMGENGTGKSSLISLLTGFKQEESGRILFLGKDLKEWLKDKRQKRDFYS
RLGILFQDVDSQLFNSTVYDEIAFGPRQLGLTEEEVSQRVQDTLSLLKIEDLRDRVPYQLSGGEKKKVAFASIMVTNPDV
YILDEPFNNLSKEYEEFFRELLHELHSAGKTIIMSAHHFKHLHHEKADVLLFEDGKADFFSAQEVLNNQQVIERLSHY