TCDB is operated by the Saier Lab Bioinformatics Group
>Q79MP5|Q79MP5_SERMA Membrane fusion protein SdeA - Serratia marcescens subsp. marcescens.
MANQPNSSFNAGGRTRAVALGQRLSGVALLAALLAGCDNSVAHNAPPPPPVVSAASVVVKPISQWDAFNGRVEAVQSVQL
RPRVSGYIERVNYTEGDEVKKGQVLFTIDDRTYRAAREQAQAELVRARNQAALARSESSRTEKLIGTQAISQEVWEQRRS
SAAQAQSNVLAAQAQLDMAQLNLDFTRVTAPIDGRASRAMITAGNLVTAGDSASVLTTLVSLDKVYVYFDVDEATFLRYQ
QQGRHDARLPVKVGLVGEDGTPHQGLVDFTDNQLNAGTGTIRMRALLDNRDRRFTPGLFARVQMPGSAEFNAMLIDDKAV
MTDQNRKFVYIVDKDGKAQRRDIDVGRMAEGLRIVQKGLANGDRVIVDGMQKVFMPGMPVDAKSVAMTTTASALN