TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7A2H0|Q7A2H0_ANASP ATP-binding protein of ABC transporter - Anabaena sp. (strain PCC 7120)
MVNNQSPPLPLLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIFDGEPIQQLQP
HQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQPQVVVKEEKQLQEQAMFLLESVGLAKKAYEYAGGL
SGGQRKLLEMGRALMTNPKLILLDEPAAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLA
DGTPAEIQTNSQVLEAYLGK