TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q7A3X3|HRTA_STAAN Putative hemin import ATP-binding protein hrtA OS=Staphylococcus aureus (strain N315) GN=hrtA PE=3 SV=1
MALVVKDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTSGTVLYNDAPLFDKQHRPSDL
RLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSSTRAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNP
KIILADEPTASLDADRATKVVEMIRQQIKEQQMIGIMITHDRRLFEYADRVIELEDGKITD