TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7AA53|Q7AA53_ECO57 Hypothetical membrane protein OS=Escherichia coli O157:H7 GN=ECs4336 PE=4 SV=1
MAVALLILLPQSRLNSSVLAMLPKQTMGDIPPALNDGFMQRLDRQLVWLVSPGKEANPLVAQEWLTLLQKSAALGDVKGP
MDAASQQAWGAFFWQHRNGLIDPNTRARLQNGGEAQAQWILSQLYSAFSGVSGKELQNDPLMLMRGSQLAMAKNGQRLRL
MDGWLVTQDPQGNYWYLLHGELAGSSFDMQQTHQLITTLNTLEKDLKTRYPQAQLLSRGTVFYSDYASQQAKQDISTLGV
ATLLGVILLIVAVFRSLRPLLLCVISIGIGALAGTVATLLIFGELHLMTLVMSMSVIGISADYTLYYLTERMVHGNDVSP
WQSLAKVRNALLLALLTTVAAYLIMMLAPFPGIRQMAIFAAVGLSASCLTVLFWHPWLCRGLPVRPVPAMALMLRWLAAW
RRNKKLSLGLPVALALFSLAGMSMLRVDDDISQLQALPQHILAQEKAITALTGQSVDQKWFVVYGDSPQQTLRRLEKYTA
SLEYAKKEGLISNYRTIPLNSLARQEEDLQLLKTAAPTVTKALQNAGLTAVNPDLNAMPVNVDEWLASPASEGWRLLWLT
LENGESGVLVPVEGVKSSALMQEIATYYPCGIAWVDRKSTFDELFALYRYVLTGLLLVALAVIACGAVARLGWRKGLISL
VPSVLSLGCGLAVLAMSGQAVNLFSLLALVLVLGIGINYTLFFSNPRGTPLTSLLAIALAMLTTLLTLGMLVFSATQAIS
SFGIVLVSGIFTAFLLSPLAMPDKKRTKK