TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7CHJ5|Q7CHJ5_YERPE Putative uncharacterized protein (Putative exported protein) OS=Yersinia pestis GN=YPO1388 PE=4 SV=1
MNKEIKRMQRMQCIYIATWLIAVFTSPIVIANNTNINGSTNNNGNGTINIFDASSNNDIHTLTGLGNEQLGGFSNHLIDS
HNNTIDGGQSNNLVSSDGNMISAISLGDGLFYGAQNNTLINSNNNLLIVTQGSTIIDSDSNTVSGISNNLIESNSNIIGN
ENSCYSDPASPSGAWCVDNQNTLIGSDNNTITGALNGLHNSHNNDIIASSVNNLMDTHNNIIAGGHYNTISGGGNNDIFG
SENNVTDSTDANINGSNNYVIDGNGIGRDDLTEDNSILGGSGNMGVGDSVTAITNSVVFGGNTSGNSTGSTLTDSVSVSG
NGTSGNNVVNIGGAANGNNSASLGTGSVSSEGGIALGSGSIATRNDELNIGDRQITSVKKGVENTDTINVSQLNDSFDDV
LNLSNEYSDNSFSTVTENINNYTDASLDTVLNTTGEYTDNSILLVTNESNNYTDNGMESVSNYANIYADESLLAIYNEEA
NYMSNLIDVTLNNANNYTDLSVNTIIYTGKQYTDSRINEYQRTFKNEFLTYSNGKFGGFDKDINQKQKQLNAGIAATMAA
AVIPQKSGSKVSIGVGLAGYSDQGAGSVGAIWHVNQRITMNTTMTYDTQRGVSLLTGLSIGI