TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7KUF9|Q7KUF9_DROME Sug, isoform D OS=Drosophila melanogaster GN=Sug PE=4 SV=2
MKATIDKELLPMKAHYFLFNAGTAPVVPFMPTLAGQLGYSPAVVGTMYTILPIIGMLAKPLFGYIADRYHRHRPLFLGGQ
VLTGIAFFLIMFVPGMEKPLPKVEFHCHQGVSDIPRFCSEYGECVERNLERYYGNRTLECELNCEAQPFMWDIVCEDWLK
NNTENCAANRTNTQMEFGASITMQKIENDGSCMFFMIPHDQGQIAGQNVTLYCPKEKEYFKSNCTMDCREDYLKEQLAES
AVINTSSAVTMPQFWLFFGLLIFSWIGMAVVVSIGDAICFGILGDRHHLYGKQRLCGSLGWGVFALLAGLLVDHMSLGEV
NKNYTAVFWMALLIMGFDVFASSKLRVSISETENPFLKLKFPYSKLQHTPTHLSSNILKDVGQMFLSVRCVIFFLWCVAI
GLGTALIWNFLFIYLEELDKAFEGCDSSIKTLEGLVMGIQCFGGELPFFFLSGWILKKIGHVNAMSVVLFGFGVRFILYS
MLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQSLVGAIFEGVGVSMGSLIAGQLFESVTARTTFEIFGI
GAFIVFVIHVCIQLYLQRNSNIDENGKGTVASASATASPSAPLETDIPKNTDHKDGDGFREVDLS