TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7NIY0|Q7NIY0_GLOVI Glr2052 protein OS=Gloeobacter violaceus (strain PCC 7421) GN=glr2052 PE=4 SV=1
MRFFSNWVRRTAMEKSMAQRWQLKDYVFAALMTVGLAVTAKVTQPFASAIPLPGATTIAWAPFAAIFLTLGMARLRRSGA
VALMAGVLALILGIISWTISAFLVAALLAAELVGLVSGGFAGRTTRLLANMAFFAATCLTGWFIGVTFLRGTPVGDLAAQ
WLTQPWVLVPAAVVSALAGAVGWWLGEQIVFQLQRAGKLDVAR