TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7NL22|Q7NL22_GLOVI Glr1304 protein OS=Gloeobacter violaceus (strain PCC 7421) GN=glr1304 PE=3 SV=1
MEGSERVMNTKCGPRPCLWLMVPIALGFSLSDTAVTAQPTVRTAIAPQSTSAQIGGEGAKALLRSAAGTAADLEHRPALW
DWTRPLSAPAKVSQAGGAASTAPAAVSQGAAAPGESADILDEVSVTATRRPTRQRDTTATTYTVKRADFQVQGARTVTDA
LVLIPGFEGPPSLGGVRNSGFNFLRGFDDQRFLVLRDGVSLQRSGNNRSDITRFNVDELESIEVVTGGATLRYGSGAVGG
VINLITETPRGLPKLTLAYEAGSYGFSRYLAKYGGGDDTLSYNLIFASLVAFNNYPYSFTLPNQARFYGPTVNPNAAASG
LAFDADGNPISSFGQPNPDPENSGDIDLYGYLKPEVGPPITVKGVADNAFNANDSYAGKLVFKPDPANKLTLSLHQQNSK
FSNDGPGAYGFIPCFGGALPPGVDNGTLSFSRFLPLNPDGSESACTVTPYIVNTASVNLGINSLLGNYAAPYTTSLDGRV
NFPAGSAYPNAEPATGTQVSYRVDNQTQTEAALFWDYTLTPTASINSYISYYRLTSTAFIAPLFFNTNFFGAGESPFAVF
QPSQPYNEGNKLEIQSALNTQLSAGQTLSFGINFVQDRSYAQVGGGTRFVDSAISRTSAFLIDDISFSDQLKANLGFRYT
YSTQFGSVGTPAVGIRYTPTNFLSLRANGSYVFNAPSIADLTVTGGFLLANPGLRPESGVTYDVGVDITPAQNLGVQVTY
FNTYLDGFIGFAALIQDGNLRFQRQNQNTRIASGIEVAANWQLTDQLRLRVAYTNTDARNVGAVDSVEQSTYPYFFQFQD
QSIPFNKIAAALSYANQRLNASLLFRYDDGKRRGVTGLGGSTDFTPSFATLDLNVEVPIAQNFTLTGSVFNLTDTQYEYL
SGIPAPGTTFRIGGRIEFGGGAQGSN