TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7NL23|Q7NL23_GLOVI Gll1303 protein OS=Gloeobacter violaceus (strain PCC 7421) GN=gll1303 PE=4 SV=1
MIIRIARKETTEIVRDGRFRLAALIVGCLLLASLAAGWKHYSDSATERAAAERVTRAQWLAQGRKNPHSAAHYGVYAFRP
QLPLASVDVGVEKYVGVAVWLEAHKQNDFRYRPAQDATAVQRFSELTAATVLQQLLPLLIVLLTFGAFADERERGTLRQV
LSLGVPRRDLALGKALGISFALSLLLVPATILGVIALALSAGPDAMITSAARMLLMGASYLVYFGIFVGLSLAVSAAVRS
SQLALVVLLAFWIGNGLVAPRAVADLARRVYPGPSALAFGQAVKQDIDNGVNGHNAADARLAVLKAQTLKQYGVKRVEDL
PINFDAIALQEGENYGNKVFDKHYGSLWQTFERQNNVYQWGALFAPLLAVRTLSMGLSGTDFAQHRDFASAAEGYRRGLI
KTMNEEMLHTEAGNWEDTVGAETWAKVPAFTYRMPSVGWVLANYSWSIVFALGWLVVGVIAAFQATIRLRVD