TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7NL24|Q7NL24_GLOVI Gll1302 protein OS=Gloeobacter violaceus (strain PCC 7421) GN=gll1302 PE=4 SV=1
MFCVESSQLEQEAQMLGPIIKHEWRNLVAQSTLWPIVGLFALLIGYGVYNGAAWVQFQQEAIQTARQDEATRLALLGKQL
VSLERGPTAELKEAPQASAWWVGYSLAGRYAVMPPGPLASLSVGQSDLYPYYFKVTTASKQAFINNNEIENPTNLLAGHF
DLAFVIVYLYPLLILALSYNLISQERDEGTLSMLLSQPVALGTFVLGKIAFRALIVLALAVAFSLAGVVLSGAELGAPDT
ALRLGLWLLVVGAYGAFWFAAAVAVNALGGSSATNAVALMGLWLAFVVLIPALVNITISAVDPMPSRLEMIQSLREASSA
ASDQSDQFLSKYQADHPELAAEGKGGFNYTDYGVRYTLVQAEVDRRVRPVLERFDAQLLRQQEWVDRYRYLSPAVVTQEA
LNDLAGTGVARYRHFLGQVEAYHRDWQKFFRADTMNKQRFSANDLQELPHFRFSEEAPGPLTERVLGSLLGLIAPALLIG
LVGLSALRRYPITG