TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q7TN37|TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus GN=Trpm4 PE=1 SV=1
MVGPEKEQSWIPKIFRKKVCTTFIVDLSDDAGGTLCQCGQPRDAHPSVAVEDAFGAAVVTEWNSDEHTTEKPTDAYGDLD
FTYSGRKHSNFLRLSDRTDPATVYSLVTRSWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLH
TGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGT
YGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEDTL
APGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRL
AVAWNRVDIAQSELFRGDIQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQ
ASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWS
DLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAARRKDLAATFESMSVDLFGECYHNSEERAAR
LLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQK
DLDFDMDSSINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVD
FQPTKPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLT
PGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILR
RVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFS
YTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRCRRCRRANLPASPVFEHFRVCLSKEAERKL
LTWESVHKENFLLAQARDKRDSDSERLKRTSQKVDTALKQLGQIREYDRRLRGLEREVQHCSRVLTWMAEALSHSALLPP
GAPPPPSPTGSKD