TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q7TN58|TMC8_MOUSE Transmembrane channel-like protein 8 OS=Mus musculus GN=Tmc8 PE=2 SV=2
MFRQWSVQSGPAPRRPESQAASEELWEQEVERLCASRTPVRMLPYAMADKRFIRELREPEGVKTTFWQRWHRPRRVARQH
LREAEQRLARGFGLWEGALYEIGGLFGTGIQSYFTFLRFLLLLNLLTMLLTACFVLLPLVWLRPPELGPALKLRLQCSSS
PLPQSDIPRFHNPLWNILTGRAFNNTYLFYGAYRAGPESSSEYSIRLAYLLSPMVCLLLCFCGILQRMAEGLPQQTLLGQ
RYRTPLSAKVFSSWDFCIRVWEAATIKKHEISNELKMELEEGRRVELAQQQTRAQKACRLLTYLRTNILIVLLVVGAISA
IFWATKYSQDNKEESLFLVLQYLPPGVISLVNFLGPQLFTVLIQLENYPPGTEVNLTLIWCVVLKLASLGMFSFSLGQTV
LCIGRNKTSCESYGYNACDYQCWENSVGEELYKLIIFNFLLTVAFAFLVSLPRRLLVERFSGWFWTWLDREEFLVPKNVL
DIVAAQTVTWMGLFYCPLLPLLNSVFLFLTFYIKKYTLLRNSRASPRRFRASSSTFFFHLVLLLGLLLAAVPLAYVISST
HSSWDCGLFTNYSAPWQVVPELVALQLPLPSQRALRYLSSHAFSFPLLILLSIVLTVCISQSRANARAIQGLRKQLVWQV
QEKWHLVDDLSRLLPELSPEPGSPHSRASRPRSFCPGFPCPGSPGPRTPRLAPSNRLSSSSLGAPSASVPASRFHFPSRT
EL