TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7UF33|Q7UF33_RHOBA Similar to integral membrane protein OS=Rhodopirellula baltica (strain SH1) GN=RB10372 PE=4 SV=1
MRTSLIASPRHTLARLLWVWRWWLFLIGCLSAIPLAIYQTDLGMDRSLAAMFSPTDPTLNQYQHLQRTFGGNLVVMLVYD
DAELMTPEGVARNRAWTNSAESIDGVRGVLSVSKLVQAFAYIRPQFSFLAGSLPSGSEAPPPPSKMLAKDDPVANSFRDL
FAGYTHGQDEKTAAIVAMLQPGQTESAIAELRRLADQIPSQRAPVLIGEPVLLDDAFDMIQADGNRLALGTIGLLSLVML
LTLRDYRVVLLATMAIVWATLCTRASIVALGMEMSLVSTILIAIIAVIVVAAVMHIGVRSRDNSNGSGESPVNESIVRVT
AFLAIPILWTCLTDAAGFASLLNSEVRPVQQFGTMTAVAALAIVAALVWFTAALMSLPSGKRTPLEPTHSNGAPSLSERF
LVHLVSVSLRHSKLLSIVSIIALIVSITMVTQLRTETSFLSNFRETSNIVQAYARVEQQLGGAGVWDVVLPAPETISPDY
VSRVQSLETKLRELEVVDSSTGEIHRLTKVLSLADADGVAAQSPLLSIVTPEVRLAGMRTAIPTFADALLTFDPPKEGET
RELRIMLRSEESLPGEVKRELIDQVSQLAQKFDERALVTGYSVLMSQLVSSLLRDQWKALAIALALVGILIGIATGSLRY
SLVALLTNTLPVMLVLAVMGLAGGGLDLGSAMIGAVSIGLSIDGSIHFLAGYQRGRSAGVDVVVAATEAATDVAAPILLA
TLALVIGFGILMTSPFIPTATFGMLIAATLAASALINLTLLPAAIVAVDGLTNSH