TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7UVJ3|Q7UVJ3_RHOBA Putative uncharacterized protein OS=Rhodopirellula baltica (strain SH1) GN=RB2593 PE=4 SV=1
MSSDSSIDQNDFVVEDMNSVVPVAWWERLGSGMISPGIGFGIVAGIASAVLYTLANISLRNAISVDPFIVSTFKAAPTVL
VLTPYLAAVKASGRPITTSRQWIPMFIPICLIGQVIGNGAFQVALGSIGLAASVPITLGSLLIGSAILGRVLLREPVRTR
TLISIATLIIAVIVLSQSRAVEPVEWSSSSADLSEEPVDWLHSPIIGALCAVSSGLAYAVFSTTMRFTMKRGMLASMAMW
ISGVSGTLALAGIVAVRTGWSPIADIPAAMWQSMILAGIFNFTAFVAISTALKVLPVVAVHLINASQVAMASVAGVIVFD
EPVTKLLVIGISLTLAGLTILATRRRPAPDPWPTFQSTFRSE