TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7W4U8|Q7W4U8_BORPA Outer membrane porin protein OmpQ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ompQ PE=4 SV=1
MRRLLVVAAMAAGSSSVFWSVAPARAANQLELYGVVDVGLATTRVSGLGTRQQVLGGGQTDNLWGLRGTEELDGGWRASF
GLESGFDAANGTRNDDARLFDYGTWVGLGHAGVGELSLGRQQSIGLQYGGQLEIASWRDMGMGALFKASDNYRVNNLVNY
LSPEFSGWQWGVGYAFDVESGDTGRFDRSPAFSTGLKYEDGPLLAAFTWDKLNLHDTSATGGRSPQALQAGFTYDFEALK
MALAWSRQRNGFVGLNGGGQIGLGPEPFAHGGAINAWLLGLEVPVHGNGAWLVQGSMARPDWHWANGQQASKAYVVTLGY
RQDLSARTSLYAYGGYMKGYDPEDPFASDVGRATRFGVGMTQRF