TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q7WTJ2|DMPP_ACICP Phenol hydroxylase P5 protein OS=Acinetobacter calcoaceticus (strain PHEA-2) GN=mphP PE=1 SV=3
MSYQVTIEPIGTTIEVEEDQTILDAALRQGVWLPFACGHGTCGTCKVQVTDGFYDVGEASPFALMDIERDENKVLACCCK
PQSDMVIEADVDEDPDFLGHLVQDYQATVIEIKDLSPTIKGIRLQLDRPIEFQAGQYINVQFPNIEGTRAFSIANSPSEV
GIVELHIRKVEGGAATTYVHEQLATGDQLDISGPYGQFFVRKSDDQNAIFIAGGSGLSSPQSMILDLLESGDSRTIYLFQ
GARDLAELYNRELFEQLVKDYPNFRYIPALNAPKPEDQWTGFTGFVHEAVADYFENRCGGHKAYLCGPPIMIDSAISTLM
QSRLFERDIHTERFLSAADGAAGQSRSALFKHI