TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7YZR6|Q7YZR6_CAEEL Calcium Channel, Alpha subunit OS=Caenorhabditis elegans GN=cca-1 PE=1 SV=1
MLRQPVPELRSFQSLSKYAGGPRSVLGRRTSAITVNRRQSQSTRRHEDVEALGSIEGSKETLQLSEHGRLASSSEASPSR
WEGRQIEWGNEEQIEEESELPYPGFAEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCD
TYRCQILDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRP
LRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYI
PEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAW
VAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKMLLNRDSISC
TGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAAKKKYTAYMEERAERKSSERQQRRKSKLDDMATLSRIEEKAEDEE
DETTITRENGDDQIEQNGDGVRIKRVKIEEEPKIKIGNGNSNGPHYKHSSSDEESDEDGEEDQVYDGEEAKKKSTPSKLW
WFREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLF
DGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCK
FCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNL
LVAILVEGFQESKEEEKRQLEEDARKQAVEEEDERKRELELIIAKTTSPAFNNGVAPAECTCQRPSSPEESPSPRLLSAN
YHPSPERKHSANLDAIIDKRLVLRNSAPFDRSPVSEGRDDSRLNRHASLVLPVANGVPYRRQRVHSWSGLCHHFNPNCPV
HGRRALIETYAREKFLEASQELKQALAEEEKRNEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWF
DYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISL
INIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGM
MYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIY
FISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLF
LHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIV
ILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVEL
FGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLIS
QFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKSDDDEIVEEHEPLAIEHVKEGELDEEEETEEGPTTQIPD
GHGGIKRLSMQVLEQELIEVERHLEERYRRASECLGGELQPLNPGEIEDLDDPEFRPRSRSHRPRARTNSALSNKSRGSH
KSAL