TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q81JL2|LYTS_BACAN Sensor protein lytS OS=Bacillus anthracis GN=lytS PE=3 SV=1
MLNLVLMMIERVGLIVILGFLLSHIKTFRRLLHKQDGYVDKLKLICIFSVFTIVSNYTGIEIAGNTIMNENWLQGVSSSS
TIANTRIMGVGISGLLGGPIVGIGVGSIAGIHRYMLGGTTALSCAISSILAGVITGYIGYIFKKYNRTITPKFSAVLSVF
IVSLEMIMILLIVEDGISIVKTIAIPMILVNSFGSFILLSMIQAILRQEENAKALQTHKVLRIADKTLPYFRQGLTEESC
KHVAQIIHRFTGTDAVSLTDTEKILAHVGLASDHHIPSHSLITGLSKEVLHTGKIMKAKSREVINCQHEGCPLQAAIVIP
LTSHGNTIGTLKLYFKNPNQLSRVEEELAEGLAKIFSTQLELGEAELQSKLLQDAEIKALQAQINPHFLFNAINTVSALC
RTDVEKARKLLLQLSVYFRCNLQGARQLLIPLEQELNHVQAYLSLEQARFPNKYEVKMYIEDELKTTLVPPFVLQLLVEN
ALRHAFPKKQPVCEVEVHVFEKEGMVHFEVKDNGQGIEEERLEQLGKMVVSSKKGTGTALYNINERLIGLFGKETMLHIE
SEVNEGTEITFVIPKKVGEEEQIVKSISS