TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q82QI0|Q82QI0_STRAW Putative uncharacterized protein OS=Streptomyces avermitilis GN=SAV_526 PE=4 SV=1
MQREWLFSLIPLTIGVVFLSFGVYGLRRAKALRRTGVTAPGRIVRHDVRRDDDGARYHHPVAAWTTPDGLECEHSSRFGR
GSIGGRFGVGALVVVRYDPENPRRFEIQGWDSAIVDRTFTILGALLTAATLTVLLVRLLTL